CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Mee Goreng with Crispy Chicken

Malaysian street-food noodles tossed with a tangy-spicy sambal base, topped with shredded chicken and crispy fried shallots. A weeknight version that skips the slow-simmered sauce and delivers that iconic mamak flavor in under 20 minutes.

Total time
20 min
Servings
2
Calories
580
Protein
38g
20-Min Mee Goreng with Crispy Chicken
casualsatisfyingmalaysianchickencrispychewyweeknightnoodle

Ingredients

  • 1.5 cups rotisserie chicken, shredded
  • 8 oz fresh egg noodles or ramen
  • 3 tbsp sambal oelek (chili paste)
  • 2 tbsp soy sauce
  • 2 tbsp lime juice
  • 2 whole eggs
  • ¼ cup fried shallots
  • ½ whole cucumber, thinly sliced

Instructions

  1. 1

    Boil salted water in a large skillet, add noodles, cook until just tender (~3 minutes), drain.

  2. 2

    Return skillet to medium-high heat with 1 tbsp oil. Crack eggs into the pan, cook until whites set but yolks jiggle.

  3. 3

    Push eggs to the side. Add sambal, soy sauce, and lime juice to the pan, stir until fragrant.

  4. 4

    Add noodles and shredded chicken back to the skillet. Toss everything together for 2 minutes until coated.

  5. 5

    Transfer to a plate. Top with fried shallots and cucumber slices. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • pot for boiling

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.