Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Mee Goreng with Crispy Chicken

Malaysian street-food noodles tossed with a tangy-spicy sambal base, topped with shredded chicken and crispy fried shallots. A weeknight version that skips the slow-simmered sauce and delivers that iconic mamak flavor in under 20 minutes.

Total time
20 min
Servings
2
Calories
580
Protein
38g
20-Min Mee Goreng with Crispy Chicken
casualsatisfyingmalaysianchickencrispychewyweeknightnoodle

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet, add noodles, cook until just tender (~3 minutes), drain.

  2. Step 2

    Return skillet to medium-high heat with 1 tbsp oil. Crack eggs into the pan, cook until whites set but yolks jiggle.

  3. Step 3

    Push eggs to the side. Add sambal, soy sauce, and lime juice to the pan, stir until fragrant.

  4. Step 4

    Add noodles and shredded chicken back to the skillet. Toss everything together for 2 minutes until coated.

  5. Step 5

    Transfer to a plate. Top with fried shallots and cucumber slices. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • pot for boiling

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.