Custrd is out on the App Store — Download it free →
Back to recipes

Moqueca Baiana

This iconic Brazilian seafood stew simmers fish and shrimp in a vibrant coconut and tomato sauce infused with cilantro and lime, all made in one pot in under 30 minutes.

Total time
25 min
Servings
2
Calories
380
Protein
42g
Moqueca Baiana
comfortlightbrazilianfishshrimptendersilkyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the fish fillet dry with paper towels, then place it on a cutting board and slice crosswise against the grain into 2-inch-wide pieces, like cutting bread into chunks.

  2. Step 2

    Place the onion on a cutting board with the root end facing left, then slice lengthwise from top to bottom into thin half-moons, about 1/4-inch thick.

  3. Step 3

    Pour 2 tablespoons of olive oil into a large heavy pot and set it over medium-high heat until the oil shimmers and slides quickly when you tilt the pot, about 90 seconds.

  4. Step 4

    Add the sliced onion to the hot oil and stir constantly with a wooden spoon for 3 minutes until the onion becomes soft and translucent, like frosted glass.

  5. Step 5

    Pour the entire can of diced tomatoes, including juice, into the pot and stir until everything is mixed evenly, about 30 seconds.

  6. Step 6

    Pour the entire can of coconut milk into the pot and stir gently for 30 seconds until the sauce is uniform and no streaks of white remain.

  7. Step 7

    Add 1 teaspoon of salt and 0.5 teaspoon of black pepper to the sauce, stir once, then bring everything to a gentle simmer over medium heat, about 2 minutes.

  8. Step 8

    Slide the fish pieces gently into the simmering sauce in a single layer, so they are mostly submerged; do not stir. Simmer for 4 minutes until the fish is opaque and flakes easily with a fork.

  9. Step 9

    Add the shrimp to the pot in a single layer and gently stir the entire stew once to distribute them evenly. Simmer for 2 minutes until the shrimp turn bright pink and firm.

  10. Step 10

    Remove the pot from heat and scatter the chopped cilantro over the entire surface of the stew, then stir gently to combine.

  11. Step 11

    Divide the moqueca between two bowls, making sure each bowl has fish, shrimp, and broth. Serve immediately with a lime wedge placed on the rim of each bowl.

Tools you’ll need

  • Large heavy pot (5-quart minimum)
  • Cutting board
  • Chef's knife
  • Paper towels
  • Wooden spoon
  • Two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.