Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Pesto Naan Pizza

Crispy naan topped with pesto, melted mozzarella, and burst cherry tomatoes — ready in minutes under the broiler. Drizzle with hot sauce if you want heat.

Total time
10 min
Servings
2
Calories
425
Protein
16g
10-Min Pesto Naan Pizza
quickcasualitalianvegetariancrispymeltyweeknightpizza

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place naan on a baking sheet and broil for 1 minute until lightly toasted.

  2. Step 2

    Spread 2 tbsp pesto on each naan, leaving a thin border.

  3. Step 3

    Top each with 0.5 cup mozzarella and scatter half the cherry tomatoes over it.

  4. Step 4

    Broil for 3–4 minutes until cheese bubbles and tomatoes begin to soften.

  5. Step 5

    Let cool 1 minute, then serve with hot sauce on the side if desired.

Tools you’ll need

  • baking sheet
  • broiler

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.