10-Min Pesto Naan Pizza
Crispy naan topped with pesto, melted mozzarella, and burst cherry tomatoes — ready in minutes under the broiler. Drizzle with hot sauce if you want heat.
- Total time
- 10 min
- Servings
- 2
- Calories
- 425
- Protein
- 16g

quickcasualitalianvegetariancrispymeltyweeknightpizza
Ingredients
- 2 pieces naan
- ¼ cup pesto
- 1 cup shredded mozzarella cheese
- 1 cup halved cherry tomatoes
Instructions
- 1
Place naan on a baking sheet and broil for 1 minute until lightly toasted.
- 2
Spread 2 tbsp pesto on each naan, leaving a thin border.
- 3
Top each with 0.5 cup mozzarella and scatter half the cherry tomatoes over it.
- 4
Broil for 3–4 minutes until cheese bubbles and tomatoes begin to soften.
- 5
Let cool 1 minute, then serve with hot sauce on the side if desired.
Tools you’ll need
- baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



