Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Cottage Cheese Strudel

Crispy phyllo wrapped around sweetened cottage cheese with a hint of lemon and cinnamon. This TikTok-easy version of túrós rétes bakes in under 20 minutes with zero fiddly lamination.

Total time
22 min
Servings
4
Calories
285
Protein
9g
Quick Cottage Cheese Strudel
comfortindulgenthungarianvegetariancheesecrispycreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F. Mix cottage cheese, sugar, lemon zest, cinnamon, and raisins in a bowl until combined.

  2. Step 2

    Lay a phyllo sheet on a clean surface. Brush lightly with melted butter. Repeat with 3 more sheets, brushing each.

  3. Step 3

    Spread half the cottage cheese mixture along one short edge of the phyllo stack, leaving a 1-inch border.

  4. Step 4

    Roll tightly into a log, tucking in the sides as you go. Transfer seam-side down to a parchment-lined sheet pan.

  5. Step 5

    Repeat steps 2–4 with remaining phyllo sheets and filling to make a second roll.

  6. Step 6

    Brush both rolls with remaining butter. Bake 18–20 minutes until golden brown and crispy. Cool 2 minutes, then slice and serve.

Tools you’ll need

  • mixing bowl
  • parchment-lined sheet pan
  • pastry brush
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.