Custrd is out on the App Store — Download it free →
Back to recipes

Shrimp Tostada with Mango

Crispy corn tortillas topped with seasoned shrimp, fresh mango, avocado, and a zesty lime crema. A bright, easy weeknight dinner.

Total time
30 min
Servings
4
Calories
380
Protein
28g
Shrimp Tostada with Mango
brightfreshMexicangluten-freeshrimpcrispycreamyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a small bowl, mix the 0.5 cup sour cream, juice of 1 lime, and a pinch of salt. Set aside.

  2. Step 2

    Pat the 1 lb shrimp dry and season with salt and pepper. Heat a large skillet over medium-high heat and add the shrimp in a single layer.

  3. Step 3

    Cook the shrimp until pink and opaque, about 2-3 minutes per side. Remove from heat and squeeze juice of 1 lime over them.

  4. Step 4

    Warm the 4 tostada shells in a dry skillet over medium heat for 1-2 minutes per side until fragrant.

  5. Step 5

    Spread a spoonful of the lime crema on each tostada. Top with shrimp, 1 diced mango, 0.5 sliced red onion, and 1 sliced avocado.

  6. Step 6

    Garnish with the 0.25 cup cilantro and serve immediately with extra lime wedges if desired.

Tools you’ll need

  • small bowl
  • large skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.