Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Minute Spinach & Feta Fatayer

Crispy, flaky pastry triangles bursting with garlicky spinach, salty feta, and a bright squeeze of lemon. No dough-making required—store-bought phyllo turns this Lebanese classic into a weeknight snack.

Total time
15 min
Servings
2
Calories
285
Protein
9g
15-Minute Spinach & Feta Fatayer
quicksatisfyinglebanesevegetarianvegetariancrispyflakysnack

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Stir spinach, feta, minced garlic, salt, and pepper in a small bowl until combined.

  2. Step 2

    Lay one phyllo sheet flat. Brush lightly with olive oil and fold in half lengthwise.

  3. Step 3

    Spoon 2 tbsp filling near the top corner, then fold into a triangle by folding corner over corner down the length of the strip.

  4. Step 4

    Repeat with remaining phyllo and filling, creating 6 triangles total.

  5. Step 5

    Heat 3 tbsp olive oil in a 10-inch nonstick skillet over medium-high until it shimmers, about 1 minute.

  6. Step 6

    Fry triangles 2–3 minutes per side until golden brown and crispy. Squeeze lemon over warm fatayer and serve immediately.

Tools you’ll need

  • small mixing bowl
  • 10-inch nonstick skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.