Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Wok Char Kway Teow

Crispy, smoky stir-fried flat rice noodles with prawns, egg, and a punchy soy-garlic sauce. The wok char gives it that signature charred edge that tastes like restaurant.

Total time
15 min
Servings
2
Calories
520
Protein
28g
15-Min Wok Char Kway Teow
satisfyingcasualmalaysianshrimpcrispychewyweeknightstir-fry

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a wok or 12-inch skillet over high heat for 30 seconds until smoking hot.

  2. Step 2

    Add 2 tbsp neutral oil. Swirl to coat, then add minced garlic and sauté 20 seconds until fragrant.

  3. Step 3

    Add prawns and cook 2 minutes until they turn pink, stirring constantly.

  4. Step 4

    Push everything to the side. Crack eggs into the empty space and scramble 30 seconds, then toss with prawns.

  5. Step 5

    Add rice noodles and soy sauce. Stir constantly for 2–3 minutes until the noodles are heated through and edges char.

  6. Step 6

    Toss in chives, stir for 10 seconds, then slide onto a plate and serve immediately.

Tools you’ll need

  • wok or 12-inch skillet
  • wooden spatula or wok turner
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.